500lovemakingtipsandsecretsreviewed.com Website Stats

500lovemakingtipsandsecretsreviewed.com
(Updated 4317 days ago)
Domain : 500lovemakingtipsandsecretsreviewed.com
Domain Title : 500 Lovemaking Tips and Secrets - Amazing Hot Sex Tips!
WRPageWRPage : Complete In-Page SEO Analysis New Feature
WRScore WRScore(beta) is calculated on the basis of pageviews, unique visitors and unique content. :
500lovemakingtipsandsecretsreviewed.com Reviewed by WebRankStats on Jul 25 . Rating: Rating: 0.67 out of 10
Website IP : 174.120.137.188
Hosting Country : United States

General Information

Meta Description : Will 500 Lovemaking Tips and Secrets really make your Passions Explode? Step Inside for My unbiased Review!
Meta Keywords : 500 lovemaking tips and secrets, 500 lovemaking tips and secrets reviewed, fun foreplay ideas, hot sex tips
XML Sitemap :
Robots.txt :
Gzip Compress :
Text/HTML Ratio : 32.16%

Website Ranks

Alexa Rank : N/A visit Alexa
Compete Rank : N/A visit Compete
Quantcast Rank : N/A visit Quantcast

Website Safety

McAfee SiteAdvisor : grey visit SiteAdvisor
WOT : Dangerous visit WOT

Pages Indexed

Google : 18 visit Google
Bing : 6 visit Bing

Sociometer

Facebook Likes : 0
Stumbleupon : 0
LinkedIn :

Server Analysis

IP Address : 174.120.137.188
Latitude : 29.7523
Longitude : -95.367
Region : Houston, Texas
Country : United States

HTTP Header Analysis

HTTP Header reponses of 500lovemakingtipsandsecretsreviewed.com is the information we get when HTTP request sent to a server from connecting clients(e.g. chrome, firefox). When you input an address into your browser it sends a request to the server hosting the domain and the server responds. HTTP Header information is not directly displayed by normal web browsers like chrome, firefox etc.

HTTP/1.1 200 OK
Date: Wed, 25 Jul 2012 02:35:03 GMT
Server: Apache
X-Pingback: http://500lovemakingtipsandsecretsreviewed.com/xmlrpc.php
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

DNS Record Analysis

There are total 6 records in domain name system (DNS) of 500lovemakingtipsandsecretsreviewed.com, which includes 1 Address(A) record, 1 Mail Exchange(MX) record, 2 Name Server(NS) records, 1 Start of Authority(SOA) record and 1 Text(TXT) record.

Host Name of the node to which this record pertains Type Type of resource record in symbolic representation. IP/Target TTL Count of seconds that the resource record stays valid. Extra Info Additional resource record-specific data
500lovemakingtipsandsecretsreviewed.com A Address Record: A 32-bit IPv4 address, most commonly used to map hostnames to an IP address of the host, but also used for DNSBLs, storing subnet masks in RFC 1101. 174.120.137.188 14400
500lovemakingtipsandsecretsreviewed.com MX Mail Exchange Record: Maps a domain name to a list of message transfer agents for that domain. 500lovemakingtipsandsecretsreviewed.com 14400 pri: 0
500lovemakingtipsandsecretsreviewed.com NS Name Server Record: Delegates a DNS zone to use the given authoritative name servers. ns2044.hostgator.com 86400
500lovemakingtipsandsecretsreviewed.com NS Name Server Record: Delegates a DNS zone to use the given authoritative name servers. ns2043.hostgator.com 86400
500lovemakingtipsandsecretsreviewed.com SOA Start of Authority Record: Specifies authoritative information about a DNS zone, including the primary name server, the email of the domain administrator, the domain serial number, and several timers relating to refreshing the zone. 86400 mname: ns2043.hostgator.com
rname: dnsadmin.gator1022.hostgator.com
serial: 2012040700
refresh: 86400
retry: 7200
expire: 3600000
minimum-ttl: 86400
500lovemakingtipsandsecretsreviewed.com TXT Text Record: Originally for arbitrary human-readable text in a DNS record. Since the early 1990s, however, this record more often carries machine-readable data, such as specified by RFC 1464, opportunistic encryption, Sender Policy Framework, DKIM, DMARC DNS-SD. 14400 txt: v=spf1 ip4:184.173.239.119 a mx include:websitewelcome.com ~all
entries: Array

Traffic Graphs

Alexa Graph